Interleukin 9, also known as IL-9, is a pleiotropic cytokine (cell signalling molecule) belonging to the group of interleukins. IL-9 is produced by variety of cells like mast cells, NKT cells, Th2, Th17, Treg, ILC2, and Th9 cells in different amounts. Among them, Th9 cells are regarded as the major CD4+ T cells that produce IL-9.

Sequence: 
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQ
PCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI with polyhistidine tag at the N-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x10⁶ IU/mg.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:

Data Sheet