Product Description

Interleukin-30 (IL-30) is a protein with a molecular weight of 28 kilodaltons, which forms one chain of the heterodimeric cytokine called interleukin 27 (IL-27), thus is sometimes called IL27-p28. The other chain of IL-27 is a molecule called Epstein-Barr induced gene-3 (EBI3). IL-30 is a member of the long-chain, 4-helix bundle family of cytokines, making it structurally similar to IL-6. This gene for this molecule is now officially called IL-27 under HGNC guidelines.

Sequence: 
MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGT
QGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLS
RAVRDLLLLSLPRRPGSAWDS with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.

Data Sheet