Active IL-12 is a p70 disulfide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation

Sequence: 
MRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRK
TSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTI
DRVMSYLNAS with polyhistidine tag at the C- terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <49 pg/mL. Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.

Data Sheet