HMGB2, Human

HMGB2, Human

HMGB2, Human

Add to cart

HMGB2 is a member of the non-histone chromosomal high-mobility group protein family, which are chromatin-associated and wildly expressed in the nucleus of higher eukaryotic cells. HMGB2 can assist cooperative interactions between cis-acting proteins by promoting DNA flexibility through bending DNA to DNA circles. In addition, HMGB2 participates in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Sequence: 
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKK
KDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSK
KKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.