Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) that can improve the body’s natural response to disease as part of the immune system. It acts by binding to the IL-3 receptor. IL-3 stimulates the differentiation of multipotent hematopoietic stem cells into myeloid progenitor cells or, with the addition of IL-7, into lymphoid progenitor cells. In addition, IL-3 stimulates proliferation of all cells in the myeloid lineage (granulocytes, monocytes, and dendritic cells), in conjunction with other cytokines, e.g., Erythropoietin (EPO), Granulocyte macrophage colony-stimulating factor (GM-CSF), and IL-6. It is secreted by basophils and activated T cells to support growth and differentiation of T cells from the bone marrow in an immune response.

Sequence:
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAP
TRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.15 ng/mL. The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg.

Purity:
>98% as determined by SDS-PAGE. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Wagemaker G et al. (1990) Biotherapy. 2,4: 337-45.
2. Guthridge MA. et al. (1998) Stem Cells. 16,5: 301-13.
3. Ihle JN. (1992) Chem Immunol. 51: 65-106.
4. Dougan M. et al. (2019) Immunity. 50,4: 796-811.

Data Sheet