Product Description

Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2).
Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15
receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132).
IL-15 is secreted by mononuclear phagocytes (and some other cells) following
infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.

Sequence:
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNI
KEFLQSFVHIVQMFINTSLE with polyhistidine tag at the N-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.01 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce MO7e human megakaryocytic leukemic proliferation. The ED₅₀ for this effect is 0.5-3 ng/mL.
The specific activity of recombinant Croyez GMP® human IL-15 is approximately 1.5 x 10⁸ IU/mg.

Purity:
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Abadie V, Jabri B. (2014) Immunol Rev. 260,1: 221-34.
2. Patidar, M. et al. (2016) Cytokine Growth Factor Rev. 31: 49-59.
3. Guo, Y. et al. (2017) Cytokine Growth Factor Rev. 38: 10-21.

Data Sheet