Interleukin-1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin-1 beta convertase) to form mature IL-1β.

Sequence:
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDP
KNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 10⁸ IU/mg.
Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is 1.8-5.1 ng/mL.

Purity:
>98% as determined by SDS-PAGE. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Yazdi AS, Ghoreschi K. (2016) Adv Exp Med Biol. 941: 21‐29.
2. Gabay C. et al. (2010) Nat Rev Rheumatol. 6,4: 232-41.
3. Lopez-Castejon G, Brough D. (2011) Cytokine Growth Factor Rev. 22,4: 189‐95
4. Weber A. et al. (2010) Sci Signal. 3,105: cm2.

 

Data Sheet