The ciliary neurotrophic factor is a protein that in humans is encoded by the CNTF gene. It is a hypothalamic neuropeptide that is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. CNTF has also been shown to be expressed by cells on the bone surface and to reduce the activity of bone-forming cells (osteoblasts)

Sequence: 
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTQSYVKHQGLNKNINLDSADGMPVASTDQWSQLTQAQRLQQNLQAYRTFHVLLARL
LQDQQVHFTPTQGDFHQAIHTLLLQVAAFAYQIQQLMILLQYKIPRNQADGMPINVGDGGLFQKKLWGLKVLQQLSQWTVRSIHDLRFISS
HQTGIPARGSHYIANNKKM with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.15 μg/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.

Data Sheet