CCL3 is belonging to the CC chemokine family. CCL3 participates in activating and recruiting cells, such as lymphocytes, monocytes, and granulocytes during acute inflammation. In addition,  CCL3 can enhance IFN-γ secretion from activated T cells and thus induces Th1 response, thereby to regulating leukocyte migration. It is reported that CCL3 is involved in susceptibility of HIV infection and disease progression of AIDS.

Sequence:
ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED₅₀ for this effect is <10 ng/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.

Data Sheet