BMP-13, Human

BMP-13, Human

BMP-13, Human

Add to cart

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP13 is a growth factor which controls proliferation and cellular differentiation in the retina and bone formation. BMP13 has a central role in regulating apoptosis during retinal development.

Sequence: 
MTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTP
ISILYIDAGNNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 63-240 ng/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within two weeks after protein reconstitution.