Bone morphogenetic protein 3, also known as osteogenic, is a protein in humans that is encoded by the BMP3 gene. The protein encoded by this gene is a member of the transforming growth factor-beta superfamily. It, like other bone morphogenetic proteins (BMP’s), is known for its ability to induce bone and cartilage development. It is a disulfide-linked homodimer. It negatively regulates bone density. BMP3 is an antagonist to other BMP’s in the differentiation of osteogenic progenitors. It is highly expressed in fractured tissues.

Sequence: 
MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENK
NVVLKVYPNMTVESCACR with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <9.5 ng/mL. Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within two weeks after protein reconstitution.

Data Sheet