Product Description

AITRL is a member of the TNF superfamily which is expressed in endothelial cells and signals through the AITR receptor. AITRL regulates T-cell proliferation and survival. It also effectuates the interaction between T lymphocytes and endothelial cells. The AITRL gene codes type II transmembrane protein comprised of 177 amino acids, including a 28 amino acid cytoplasmic region, a 21 amino acid transmembrane domain and a 128 amino acid extracellular domain.

Sequence: 
MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGG
TYELHVGDTIDLIFNSEHQVLKNNTYWGII LIANPQEI with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <2.5 ng/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within two weeks after protein reconstitution.

Data Sheet