🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
Galectin-2, Human

Galectin-2, Human

Galectin-2, Human

Add to cart

Galectin2, is a soluble beta-galactoside binding lectin. This protein induces apoptosis in activated T cells and binds to the cytokine lymphotoxin-alpha (LTA) with possible implications in risk of myocardial infarction. Galetin-2 also modulates cell-to-cell adhesion and cell-to-extracellular matrix interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis.

Sequence:
TGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFK
VKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE with polyhistidine tag at the N-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <20 μg/mL. Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.