4-1BBL, Mouse

4-1BBL, Mouse

4-1BBL, Mouse

Add to cart

4-1BB Ligand Human Recombinant protein. 4-1BBL is a transmembrane cytokine that is part of the tumor necrosis factor (TNF) ligand family. Recombinant human 4-1BB ligand is intended for use in cell culture applications. 4-1BBL and its interaction with 4-1BB is involved in the antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells.

Sequence: 
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVD
SPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAY
RDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <0.05 μg/mL. Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.