Thrombopoietin (TPO) is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets.

Sequence:
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQL
SGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with
polyhistidine tag at the N-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.01 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <2 ng/mL. Purity:
>95% as determined by SDS-PAGE. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within two weeks after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Hitchcock IS, Kaushansky K. (2014) Br J Haematol. 165,2: 259‐68.
2. Kuter DJ. (2013) Int J Hematol. 98,1: 10-23.
3. Kaushansky K. (1998) N Engl J Med. 339,11: 746-54.
4. Baatout S. (1997) Haemostasis. 27,1: 1-8.

Data Sheet